Se rendre au contenu

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 9(PCR9)

https://www.paratuberculosis.info/web/image/product.template/117049/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:P0CW98 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQEGKNEKKVTEGQWTTGLYDCLSEDISTCCFTWVCPCVAFGRIAEILDKGETSRGLA GLMVVAMSSIGCGWYYASKYRAKLRHQYALPEAPCADGAIHCFCCPCALTQEHRELKHRG LDPSLGWNIENGGLNSNTPPFVASGMDR Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 9 Short name= AtPCR9 Gene Names:Name:PCR9 Ordered Locus Names:At1g58320 ORF Names:F19C14.14 Expression Region:1-148 Sequence Info:fµLl length protein

1.491,00 € 1491.0 EUR 1.491,00 €

1.491,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables