ELISA Recombinant Group XIIA secretory phospholipase A2(PLA2G12A),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Metabolism Uniprot ID: Q9BZM1 Gene Names: PLA2G12A Organism: Homo sapiens () AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE Expression Region: 23-185aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 20.3 kDa Alternative Name(s): Phosphatidylcholine 2-acylhydrolase 12A Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. Reference: Cloning and recombinant expression of a structurally novel secreted phospholipase A2.Gelb M.H., Valentin E., Ghomashchi F., Lazdunski M., Lambeau G.J. Biol. Chem. 275:39823-39826(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.