ELISA Recombinant Growth-differentiation factor 15 protein(GDF15)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: CardiovascµLar
Uniprot ID: Q99988
Gene Names: GDF15
Organism: Homo sapiens ()
AA Sequence: RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Expression Region: 198-308aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 14.2 kDa
Alternative Name(s): Macrophage inhibitory cytokine 1 ;MIC-1NSAID-activated gene 1 protein ;NAG-1NSAID-regµLated gene 1 protein ;NRG-1;Placental TGF-betaPlacental bone morphogenetic protein;Prostate differentiation factor
Relevance:
Reference: PLAB, a novel placental bone morphogenetic protein.Hromas R., Hufford M., Sutton J., Xu D., Li Y., Lu L.Biochim. Biophys. Acta 1354:40-44(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-YP859530HU