ELISA Recombinant Nucleolin(NCL),Partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20171228
Research areas: Epigenetics and Nuclear Signaling
Target / Protein: NCL
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens ()
Delivery time: 3-7 business days
Uniprot ID: P19338
AA Sequence: VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS
Tag info: N-terminal 6xHis-tagged
Expression Region: 2-482aa
Protein length: Partial
MW: 54.4 kDa
Alternative Name(s):
Relevance:
Reference: "Stress-dependent nucleolin mobilization mediated by p53-nucleolin complex formation."Daniely Y., Dimitrova D.D., Borowiec J.A. Mol. Cell. Biol. 22:6014-6022(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-YP015535HU