ELISA Recombinant Metallothionein-2(MT2A),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: P02795 Gene Names: MT2A Organism: Homo sapiens () AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC Expression Region: 1-59aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 7.9 kDa Alternative Name(s): Metallothionein-2AMetallothionein-II ;MT-II Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regµLated by both heavy metals and glucocorticoids. Reference: Primary structure of hepatic metallothionein.Kissling M.M., Kaegi J.H.R.FEBS Lett. 82:247-250(1977) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.