ELISA Recombinant Lymphocyte antigen 6H(LY6H)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Cell Biology Uniprot ID: O94772 Gene Names: LY6H Organism: Homo sapiens () AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG Expression Region: 26-115aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 11.9 kDa Alternative Name(s): Short name: Ly-6H Relevance: Reference: "Isolation and characterization of a new member of the Ly6 gene family (LY6H)."Horie M., Okutomi K., Taniguchi Y., Ohbuchi Y., Suzuki M., Takahashi E.Genomics 53:365-368(1998) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.