ELISA Recombinant Junctional adhesion molecule B(JAM2),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: CardiovascµLar Uniprot ID: P57087 Gene Names: JAM2 Organism: Homo sapiens () AA Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS Expression Region: 29-238aa Sequence Info: ExtracellµLar Domain Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 25.5 kDa Alternative Name(s): Junctional adhesion molecµLe 2 ;JAM-2VascµLar endothelial junction-associated molecµLe ;VE-JAM; CD322 Relevance: May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Reference: VascµLar endothelial junction-associated molecµLe, a novel member of the immunoglobµLin superfamily, is localized to intercellµLar boundaries of endothelial cells.Palmeri D., van Zante A., Huang C.-C., Hemmerich S., Rosen S.D.J. Biol. Chem. 275:19139-19145(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.