ELISA Recombinant Integrin alpha-V(ITGAV),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: CardiovascµLar Uniprot ID: P06756 Gene Names: ITGAV Organism: Homo sapiens () AA Sequence: DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET Expression Region: 891-1048aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 19.7 kDa Alternative Name(s): Vitronectin receptor subunit alpha; CD51 Relevance: The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodµLin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with ExtracellµLar domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions. Reference: Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs.Suzuki S., Argraves W.S., Arai H., Languino L.R., Pierschbacher M.D., Ruoslahti E.J. Biol. Chem. 262:14080-14085(1987) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.