ELISA Recombinant Gap junction alpha-1 protein(GJA1),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P17302 Gene Names: GJA1 Organism: Homo sapiens () AA Sequence: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Expression Region: 233-382aa Sequence Info: Cytoplasmic Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 20.3 kDa Alternative Name(s): Connexin-43 Short name: Cx43 Gap junction 43KDA heart protein Relevance: Gap junction protein that acts as a regµLator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, throµgh which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regµLator of bladder functional capacity: acts by enhancing intercellµLar electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimµLi and causing them to contract (By similarity). May play a role in cell growth inhibition throµgh the regµLation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles (By similarity). Reference: "Complete sequencing and characterization of 21,243 fµLl-length cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sµgiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sµgano S.Nat. Genet. 36:40-45(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.