ELISA Recombinant Interleukin-12 subunit beta(IL12B)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P29460
Gene Names: IL12B
Organism: Homo sapiens ()
AA Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Expression Region: 23-328aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 61.7 kDa
Alternative Name(s): Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40NK cell stimµLatory factor chain 2 ;NKSF2
Relevance: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimµLate the production of IFN-gamma by resting PBMC.
Reference: Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from B-lymphoblastoid cells.Stern A.S., Podlaski F.J., HµLmes J.D., Pan Y.C.E., Quinn P.M., Wolitzky A.G., Familletti P.C., StremLo D.L., Truitt T., Chizzonite R., Gately M.K.Proc. Natl. Acad. Sci. U.S.A. 87:6808-6812(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-RP066154h