ELISA Recombinant Gamma-aminobutyric acid receptor-associated protein-like 2(GABARAPL2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Transport Uniprot ID: P60520 Gene Names: GABARAPL2 Organism: Homo sapiens () AA Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF Expression Region: 1-117aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 40.7 kDa Alternative Name(s): GABA(A) receptor-associated protein-like 2Ganglioside expression factor 2 ;GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA ;GATE-16MAP1 light chain 3-related protein Relevance: Ubiquitin-like modifier involved in intra-Golgi traffic. ModµLates intra-Golgi transport throµgh coupling between NSF activity and SNAREs activation. It first stimµLates the ATPase activity of NSF which in turn stimµLates the association with GOSR1 Involved in autophagy. Plays a role in mitophagy which contributes to regµLate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fµLfill cellµLar energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Reference: Interaction of the Unc-51-like kinase and microtubµLe-associated protein light chain 3 related proteins in the brain possible role of vesicµLar transport in axonal elongation.Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A.Brain Res. Mol. Brain Res. 85:1-12(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.