ELISA Recombinant L-lactate dehydrogenase A chain(LDHA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Metabolism Uniprot ID: P00338 Gene Names: LDHA Organism: Homo sapiens () AA Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL Expression Region: 5-323aa Sequence Info: Partial Source: E.coli Tag Info: NO-tagged MW: 35.1 kDa Alternative Name(s): Relevance: Cell proliferation-inducing gene 19 protein LDH muscle subunit Reference: "Nucleotide sequences of the cDNA and an intronless pseudogene for lactate dehydrogenase-A isozyme." Tsujibo H., Tiano H.F., Li S.S.-L. Eur. J. Biochem. 147:9-15(1985) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.