Skip to Content

ELISA Recombinant Novel Coronavirus Spike glycoprotein(S)(V483A),partial (Active)

https://www.paratuberculosis.info/web/image/product.template/136007/image_1920?unique=706639d
Quantity:100µg. Research Areas:Microbiology Uniprot NO.:P0DTC2 Uniprot Entry Name: Gene Names:S Species:Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) Source:Mammalian cell Expression Region:319-541aa (V483A) Sequence:RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF Protein Description:Partial Tag Info:C-terminal 10xHis-tagged Mol. Weight:27.8 kDa Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 ?g/mL can bind ACE2 (CSB-MP866317HU), the EC50 is 196.4-272.1 ng/mL. ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 ?g/mL can bind SARS-CoV-2-S Antibody (CSB-RA33245A1GMY), the EC50 is 7.481- 18.76 ng/mL. Purity:Greater than 90% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link:

896.00 € 896.0 EUR 896.00 €

896.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-MP3324GMY1(M5)