Skip to Content

ELISA Recombinant Lymphotoxin-alpha(LTA) (Active)

https://www.paratuberculosis.info/web/image/product.template/134901/image_1920?unique=706639d
Quantity:100µg. Research Areas:Cytokine Uniprot NO.:P01374 Uniprot Entry Name: Gene Names:LTA Species:Homo sapiens () Source:Mammalian cell Expression Region:35-205aa Sequence:LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Protein Description:FµLl Length of Mature Protein Tag Info:N-terminal 6xHis-tagged Mol. Weight:20.8 Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/mL can bind TNFRSF1B (CSB-MP023978HU2), the EC50 is 1.632-2.699 ng/mL.?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/mL can bind TNFR1?CSB-MP023977HU1?, the EC50 of LTA protein is 4.409-6.797 ng/mL. Purity:Greater than 95% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias: Relevance: PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link:

543.00 € 543.0 EUR 543.00 €

543.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-MP013218HU