ELISA Recombinant Glucagon receptor(GCGR),partial (Active)

Quantity:100µg. Research Areas:Cancer Uniprot NO.:P47871 Uniprot Entry Name: Gene Names:GCGR Species:Homo sapiens () Source:Mammalian cell Expression Region:26-136aa Sequence:AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK Protein Description:Partial Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged Mol. Weight:18.1 kDa Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized GCGR at 2 ?g/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL. Purity:Greater than 95% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:(GL-R) Relevance:G-protein coupled receptor for glucagon that plays a central role in the regµLation of blood glucose levels and glucose homeostasis. RegµLates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modµLates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: