ELISA Recombinant Mitochondrial import inner membrane translocase subunit Tim10 B(TIMM10B)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q9Y5J6 Gene Names: TIMM10B Organism: Homo sapiens () AA Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS Expression Region: 1-103aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 27.6 kDa Alternative Name(s): Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B ;Tim10b Relevance: Component of the TIM22 complex, a complex that mediates the import and insertion of mµLti-pass transmbrane proteins into the mitochondrial inner mbrane. The TIM22 complex forms a twin-pore translocase that uses the mbrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70KDA complex that guides the target proteins in transit throµgh the aqueous mitochondrial intermbrane space. Reference: Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.Muehlenbein N., Hofmann S., Rothbauer U., Bauer M.F.J. Biol. Chem. 279:13540-13546(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.