ELISA Recombinant Mitochondrial peptide methionine sulfoxide reductase(MSRA)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Metabolism Uniprot ID: Q9UJ68 Gene Names: MSRA Organism: Homo sapiens () AA Sequence: GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK Expression Region: 24-235aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 27.5 kDa Alternative Name(s): Peptide-methionine (S)-S-oxide reductase ;Peptide Met(O) reductaseProtein-methionine-S-oxide reductase ;PMSR Relevance: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sµLfoxide in proteins to methionine. Reference: Gene structure, localization and role in oxidative stress of methionine sµLfoxide reductase A (MSRA) in the monkey retina.Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.Exp. Eye Res. 82:816-827(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.