ELISA Recombinant GrpE protein homolog 1, mitochondrial(GRPEL1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q9HAV7 Gene Names: GRPEL1 Organism: Homo sapiens () AA Sequence: CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA Expression Region: 1-217aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 48.3 kDa Alternative Name(s): HMGE Mt-GrpE#1 Relevance: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Reference: "Identification and characterization of a mitochondrial homologue of the bacterial co-chaperone GrpE." Choglay A.A., Chapple J.P., Blatch G.L., Cheetham M.E. Gene 267:125-134(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.