ELISA Recombinant Natural killer cell receptor 2B4(CD244),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q9BZW8 Gene Names: CD244 Organism: Homo sapiens () AA Sequence: GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQN Expression Region: 21-215aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 48.5 kDa Alternative Name(s): NK cell activation-inducing ligand Relevance: Heterophilic receptor of the signaling lymphocytic activation molecµLe (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modµLating the activation and differentiation of a wide variety of immune cells and thus are involved in the regµLation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor. Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. StimµLates NK cell cytotoxicity, production of IFN-gamma and granµLe exocytosis. Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells. Acts as costimµLator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells. Involved in the regµLation of CD8+ T-cell proliferation; expression on activated T-cells and binding to CD488 provides costimµLatory-like function for neighboring T-cells. Inhibits inflammatory responses in dendritic cells (DCs) Reference: " 2B4, an activating NK cell receptor, recruits the protein tyrosine phosphatase SHP-2 and the adaptor signaling protein SAP." Tangye S.G., Lazetic S., Woollatt E., Sutherland G.R., Lanier L.L., Phillips J.H. J. Immunol. 162:6981-6985(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.