ELISA Recombinant Interleukin-1 family member 10(IL1F10)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q8WWZ1 Gene Names: IL1F10 Organism: Homo sapiens () AA Sequence: MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW Expression Region: 1-152aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 32.9 kDa Alternative Name(s): Family of interleukin 1-theta ;FIL1 thetaInterleukin-1 HY2 ;IL-1HY2Interleukin-1 theta ;IL-1 thetaInterleukin-38 ;IL-38 Relevance: Cytokine with immunomodµLatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimµLated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. Reference: Identification of a novel cytokine gene in the interleukin gene cluster on chromosome 2q12-14.Bensen J.T., Dawson P.A., Mychaleckyj J.C., Bowden D.W.J. Interferon Cytokine Res. 21:899-904(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.