ELISA Recombinant Mitochondrial import receptor subunit TOM34(TOMM34)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q15785
Gene Names: TOMM34
Organism: Homo sapiens ()
AA Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Expression Region: 1-309aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 61.6 kDa
Alternative Name(s): Translocase of outer membrane 34KDA subunit
Relevance: Plays a role in the import of cytosolically syntheQuantityd preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellµLar components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly syntheQuantityd precursors in an unfolded import compatible state.
Reference: "hTom34: a novel translocase for the import of proteins into mitochondria." Nuttall S.D., Hanson B.J., Mori M., Hoogenraad N.J. DNA Cell Biol. 16:1067-1074(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP623014HU