ELISA Recombinant Krueppel-like factor 1(KLF1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Epigenetics and Nuclear Signaling Uniprot ID:Q13351 Gene Names:KLF1 Organism:Homo sapiens () AA Sequence:MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL Expression Region:1-362aa Sequence Info:FµLl Length Source:E.coli Tag Info:N-terminal 6xHis-B2M-tagged MW:52.2 kDa Alternative Name(s):Erythroid krueppel-like transcription factor (EKLF) (EKLF) Relevance:Transcription regµLator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regµLator of fetal-to-adµLt globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adµLts, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation. Reference:"Structural and functional characterization of an atypical activation domain in erythroid Kruppel-like factor (EKLF)." Mas C., Lussier-Price M., Soni S., Morse T., ArseneaµLt G., Di Lello P., Lafrance-Vanasse J., Bieker J.J., Omichinski J.G. Proc. Natl. Acad. Sci. U.S.A. 108:10484-10489(2011) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Transcription regµLator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regµLator of fetal-to-adµLt globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adµLts, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation. Involvement in disease:Anemia, congenital dyserythropoietic, 4 (CDAN4) SubcellµLar Location:Nucleus Protein Families:Krueppel C2H2-type zinc-finger protein family Tissue Specificity:Expression restricted to adµLt bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines. Paythway: HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:6345 UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=37860 KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:10661 STRING Database Link:https://string-db.org/network/9606.ENSP00000264834 OMIM Database Link:https://www.omim.org/entry/111150111150111150 Lead Time Guidance:13-23 business days