ELISA Recombinant Inter-alpha-trypsin inhibitor heavy chain H3(ITIH3),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q06033 Gene Names:ITIH3 Organism:Homo sapiens () AA Sequence:MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD Expression Region:512-651aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged MW:51.2 kDa Alternative Name(s):Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP) Relevance:May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regµLate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes. Reference:"Inhibition of tumor growth and metastatic spreading by overexpression of inter-alpha-trypsin inhibitor family chains." Paris S., Sesboue R., Delpech B., Chauzy C., Thiberville L., Martin J.P., Frebourg T., Diarra-Mehrpour M. Int J Cancer 97:615-620(2002) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days