ELISA Recombinant Gamma-synuclein(SNCG)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: O76070 Gene Names: SNCG Organism: Homo sapiens () AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Expression Region: 1-127aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 29.3 kDa Alternative Name(s): Breast cancer-specific gene 1 protein;Persyn;Synoretin ;SR Relevance: Plays a role in neurofilament network integrity. May be involved in modµLating axonal architecture during development and in the adµLt. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases May also function in modµLating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway Reference: Initial characterization of the central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.