ELISA Recombinant Myeloblastin(PRTN3)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Signal Transduction Uniprot ID:P24158 Gene Names:PRTN3 Organism:Homo sapiens () AA Sequence:IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR Expression Region:28-248aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:31.7 kDa Alternative Name(s):AGP7 (C-ANCA antigen) (Leukocyte proteinase 3) (PR-3) (PR3) (Neutrophil proteinase 4) (NP-4) (P29) (Wegener autoantigen) (MBN) Relevance:Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV. By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascµLar integrity during neutrophil transendothelial migration. May play a role in neutrophil transendothelial migration, probably when associated with CD177. Reference:"Donor-recipient polymorphism of the proteinase 3 gene: a potential target for T-cell alloresponses to myeloid leukemia." Clave E., Molldrem J., Hensel N., Raptis A., Barrett A.J. J. Immunother. 22:1-6(1999) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:13-23 business days