ELISA Recombinant Peptidoglycan recognition protein 1(PGLYRP1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cancer Uniprot ID:O75594 Gene Names:PGLYRP1 Organism:Homo sapiens () AA Sequence:QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Expression Region:22-196aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:26.9 kDa Alternative Name(s):Peptidoglycan recognition protein short (PGRP-S) (PGLYRP) (PGRP) (TNFSF3L) Relevance:Pattern receptor that binds to murein peptidoglycans of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity. Reference:"Peptidoglycan recognition proteins are a new class of bactericidal proteins." Lu X., Wang M., Qi J., Wang H., Li X., Gupta D., Dziarski R. J. Biol. Chem. 281:5895-5907(2006) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days