ELISA Recombinant NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3(NDUFA3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Transport Uniprot ID: O95167 Gene Names: NDUFA3 Organism: Homo sapiens () AA Sequence: AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL Expression Region: 2-84aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 36.1 kDa Alternative Name(s): Complex I-B9 ;CI-B9NADH-ubiquinone oxidoreductase B9 subunit Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Reference: The consensus coding sequences of breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., BuckhaµLts P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., PapadopoµLos N., Vogelstein B., Kinzler K.W., VelcµLescu V.E.Science 314:268-274(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.