ELISA Recombinant Myelin expression factor 2(MYEF2),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Transcription Uniprot ID: Q9P2K5 Gene Names: MYEF2 Organism: Homo sapiens () AA Sequence: GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE Expression Region: 372-576aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 37.3 kDa Alternative Name(s): MST156 Relevance: Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 elent 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.