ELISA Recombinant Metallothionein-3(MT3)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170725
Research areas: Neuroscience
Target / Protein: MT3
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens ()
Delivery time: 3-7 business days
Uniprot ID: P25713
AA Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-68aa
Protein length: FµLl Length
MW: 22.9 kDa
Alternative Name(s): GIFB Short name: GIF Growth inhibitory factor Metallothionein-III Short name: MT-III
Relevance: Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Reference: "The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein."Uchida Y., Takio K., Titani K., Ihara Y., Tomonaga M.Neuron 7:337-347(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP015122HU