ELISA Recombinant Lipopolysaccharide-responsive and beige-like anchor protein(LRBA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P50851 Gene Names: LRBA Organism: Homo sapiens () AA Sequence: PQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPV Expression Region: 1267-1500aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 29.8 kDa Alternative Name(s): Beige-like protein;CDC4-like protein Relevance: May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or mbrane deposition of immune effector molecµLes. Reference: Deleterious mutations in LRBA are associated with a syndrome of immune deficiency and autoimmunity.Lopez-Herrera G., Tampella G., Pan-Hammarstrom Q., Herholz P., Trujillo-Vargas C.M., Phadwal K., Simon A.K., Moutschen M., Etzioni A., Mory A., Srµgo I., Melamed D., HµLtenby K., Liu C., Baronio M., Vitali M., Philippet P., Dideberg V. , Aghamohammadi A., Rezaei N., Enright V., Du L., Salzer U., Eibel H., Pfeifer D., Veelken H., Stauss H., Loµgaris V., Plebani A., Gertz E.M., Schaffer A.A., Hammarstrom L., Grimbacher B.Am. J. Hum. Genet. 90:986-1001(2012) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.