ELISA Recombinant Left-right determination factor 2(LEFTY2)
Quantity:100µg. Other Quantitys are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:O00292
Gene Names:LEFTY2
Organism:Homo sapiens ()
AA Sequence:RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Expression Region:77-366aa
Sequence Info:FµLl Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:39.8 kDa
Alternative Name(s):Endometrial bleeding-associated factor (Left-right determination factor A) (Protein lefty-2) (Protein lefty-A) (Transforming growth factor beta-4) (TGF-beta-4) (EBAF) (LEFTA) (LEFTYA) (TGFB4)
Relevance:Required for left-right asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
Reference:"Nodal signals to Smads throµgh Cripto-dependent and Cripto-independent mechanisms." Yeo C., Whitman M. Mol. Cell 7:949-957(2001)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
SubcellµLar Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
Internal Reference:
CSB-EP012858HU