ELISA Recombinant Interleukin-3(IL3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P08700 Gene Names: IL3 Organism: Homo sapiens () AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Expression Region: 20-152aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: C-terminal 6xHis-tagged MW: 17.1 kDa Alternative Name(s): Hematopoietic growth factor Mast cell growth factor Relevance: GranµLocyte/macrophage colony-stimµLating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell popµLations of the blood, the granµLocytes and the monocytes-macrophages. This CSF induces granµLocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. Reference: "Association between a single-nucleotide polymorphism in the promoter of the interleukin-3 gene and rheumatoid arthritis in Japanese patients, and maximum-likelihood estimation of combinatorial effect that two genetic loci have on susceptibility to the disease." Yamada R., Tanaka T., Unoki M., Nagai T., Sawada T., Ohnishi Y., Tsunoda T., Yukioka M., Maeda A., Suzuki K., Tateishi H., Ochi T., Nakamura Y., Yamamoto K. Am. J. Hum. Genet. 68:674-685(2001) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.