ELISA Recombinant Interleukin-1 beta(IL1B)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P01584 Gene Names: IL1B Organism: Homo sapiens () AA Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Expression Region: 117-269aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 44.4 kDa Alternative Name(s): Catabolin Relevance: Produced by activated macrophages, IL-1 stimµLates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimµLate the release of prostaglandin and collagenase from synovial cells. Reference: Nucleotide sequence of monocyte interleukin 1 precursor cDNA.Auron P.E., Webb A.C., Rosenwasser L.J., Mucci S.F., Rich A., Wolff S.M., Dinarello C.A.Proc. Natl. Acad. Sci. U.S.A. 81:7907-7911(1984) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.