ELISA Recombinant Platelet glycoprotein Ib alpha chain(GP1BA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P07359 Gene Names: GP1BA Organism: Homo sapiens () AA Sequence: SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL Expression Region: 553-652aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 15.9 kDa Alternative Name(s): Antigen CD42b-alpha CD_antigen: CD42b Relevance: GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plµgs by binding to the A1 domain of vWF, which is already bound to the subendothelium. Reference: "Identification of a novel point mutation in platelet glycoprotein Ibalpha, Gly to Ser at residue 233, in a Japanese family with platelet-type von Willebrand disease." Matsubara Y., Murata M., Sµgita K., Ikeda Y. J. Thromb. Haemost. 1:2198-2205(2003) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.