ELISA Recombinant Glutaminase kidney isoform, mitochondrial(GLS),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: O94925 Gene Names: GLS Organism: Homo sapiens () AA Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL Expression Region: 616-669aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 33.3 kDa Alternative Name(s): K-glutaminase L-glutamine amidohydrolase Relevance: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. RegµLates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. Reference: "Cloning and analysis of unique glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.