ELISA Recombinant Growth hormone receptor(GHR),partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20171228
Research areas: Cell Biology
Target / Protein: GHR
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Sus scrofa (Pig)
Delivery time: 3-7 business days
Uniprot ID: P19756
AA Sequence: FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR
Tag info: C-terminal 6xHis-tagged
Expression Region: 19-264aa
Protein length: Partial
MW: 30.3 kDa
Alternative Name(s): Somatotropin receptor
Relevance: Receptor for pituitary gland growth hormone involved in regµLating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modµLator/inhibitor of GH signaling.
Reference: "Porcine growth hormone receptor cDNA sequence." Cioffi J.A., Wang X., Kopchick J.J. Nucleic Acids Res. 18:6451-6451(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP009411PI-GB