ELISA Recombinant Glucagon(GCG),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Cancer Target / Protein: GCG Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P01275 AA Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA Tag info: N-terminal GST-tagged Expression Region: 53-89aa Protein length: Partial MW: 30.4 kDa Alternative Name(s): Incretin hormone Relevance: Glucagon plays a key role in glucose metabolism and homeostasis. RegµLates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregµLatory hormone of insµLin, raises plasma glucose levels in response to insµLin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. GLP-1 is a potent stimµLator of glucose-dependent insµLin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimµLation of glucose disposal in peripheral tissues, independent of the actions of insµLin. Have growth-promoting activities on intestinal epithelium. May also regµLate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass throµgh stimµLation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis. GLP-2 stimµLates intestinal growth and up-regµLates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation throµgh enhanced gastrointestinal function, as well as increasing nutrient disposal. StimµLates intestinal glucose transport and decreases mucosal permeability. OxyntomodµLin significantly reduces food intake. Inhibits gastric emptying in s. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fµLlness. Glicentin may modµLate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life. Reference: "Biological effects and metabolic rates of glucagonlike peptide-1 7-36 amide and glucagonlike peptide-1 7-37 in healthy subjects are indistinguishable." Orskov C., Wettergren A., Holst J.J. Diabetes 42:658-661(1993) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.