Skip to Content

ELISA Recombinant Homeobox protein engrailed-1(EN1)

https://www.paratuberculosis.info/web/image/product.template/121946/image_1920?unique=3f1195a
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Neuroscience Target / Protein: EN1 Biologically active: Not Tested Expression system: E.coli Species of origin: Gallus gallus (Chicken) Delivery time: 3-7 business days Uniprot ID: Q05916 AA Sequence: MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE Tag info: N-terminal 6xHis-B2M-tagged Expression Region: 1-333aa Protein length: FµLl Length MW: 48.5 kDa Alternative Name(s): Short name:Gg-En-1 Short name:Homeobox protein en-1 Relevance: Reference: "Cloning and sequence comparison of the mouse, , and chicken engrailed genes reveal potential functional domains and regµLatory regions."Logan C., Hanks M.C., Noble-Topham S., Nallainathan D., Provart N.J., Joyner A.L.Dev. Genet. 13:345-358(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-EP007659CH