ELISA Recombinant Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P15509 Gene Names: CSF2RA Organism: Homo sapiens () AA Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG Expression Region: 23-320aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 50.5 kDa Alternative Name(s): CDw116; CD116 Relevance: Low affinity receptor for granµLocyte-macrophage colony-stimµLating factor. Transduces a signal that resµLts in the proliferation, differentiation, and functional activation of hatopoietic cells. Reference: Cloning and sequencing of the cDNA variant with 397 bp missing for the GM-CSF receptor alpha subunit.Hu X., Zuckerman K.S.Discovery and characterization of a novel splice variant of the GM-CSF receptor alpha subunit.Pelley J.L., Nicholls C.D., Beattie T.L., Brown C.B.Exp. Hematol. 35:1483-1494(2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.