ELISA Recombinant N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P20933 Gene Names: AGA Organism: Homo sapiens () AA Sequence: TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI Expression Region: 206-346aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 31.1 kDa Alternative Name(s): Aspartylglucosaminidase;Glycosylasparaginase;N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase Relevance: Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins. Reference: Cloning and sequence analysis of a cDNA for glycosylasparaginase. A single gene encodes the subunits of this lysosomal amidase.Fisher K.J., Tollersrud O.-K., Aronson N.N. Jr.FEBS Lett. 269:440-444(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.