Skip to Content

ELISA Recombinant Mitochondrial carrier homolog 2(MTCH2)

https://www.paratuberculosis.info/web/image/product.template/135337/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9Y6C9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHI ASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVI KETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAG LVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASmLTYPFVLVS NLMAVNNCGLAGGCPPYSPIYTSWIDCWCmLQKEGNMSRGNSLFFRKVPFGKTYCCDLKM LI Protein Names:Recommended name: Mitochondrial carrier homolog 2 Alternative name(s): Met-induced mitochondrial protein Gene Names:Name:MTCH2 Synonyms:MIMP ORF Names:HSPC032 Expression Region:2-303 Sequence Info:fµLl length protein

1,654.00 € 1654.0 EUR 1,654.00 €

1,654.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF897586HU