ELISA Recombinant Membrane progestin receptor gamma(PAQR5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NXK6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFAWRFVTALYMTDIKNDSYSWPmLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRL CKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAIL LCIIFSLSNIIYFSAALYRIPKPELHKKET Protein Names:Recommended name: Membrane progestin receptor gamma Short name= mPR gamma Alternative name(s): Progestin and adipoQ receptor family member 5 Progestin and adipoQ receptor family member V Gene Names:Name:PAQR5 Synonyms:MPRG Expression Region:1-330 Sequence Info:fµLl length protein