Skip to Content

ELISA Recombinant Palmitoyltransferase ZDHHC18(ZDHHC18)

https://www.paratuberculosis.info/web/image/product.template/136704/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NUE0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSG SLGRRPRRKWEVFPGRNRFYCGGRLmLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKL TLAIPIIAAILFFFVMSCLLQTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTR EVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAF ILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVLELVICFFSIWSILGLSGFHT YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQS DTVLPSPIRSDEPACRAKPDASMVGGHP Protein Names:Recommended name: Palmitoyltransferase ZDHHC18 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 18 Short name= DHHC-18 Gene Names:Name:ZDHHC18 Expression Region:1-388 Sequence Info:fµLl length protein

1,745.00 € 1745.0 EUR 1,745.00 €

1,745.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF889113HU