ELISA Recombinant Potassium channel subfamily K member 9(KCNK9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NPC2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS FTDHQRLMKRRKSV Protein Names:Recommended name: Potassium channel subfamily K member 9 Alternative name(s): Acid-sensitive potassium channel protein TASK-3 TWIK-related acid-sensitive K(+) channel 3 Two pore potassium channel KT3.2 Short name= Two pore K(+) chan Gene Names:Name:KCNK9 Synonyms:TASK3 Expression Region:1-374 Sequence Info:fµLl length protein