Skip to Content

ELISA Recombinant Melanocyte-stimulating hormone receptor(MC1R)

https://www.paratuberculosis.info/web/image/product.template/149644/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q9TU05 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVLGPERRLLASLSSAPPAAPRLGLAANQTNQTGPQCLEVSIPDGLFLSLGLVSLVENV LVVAAIAKNRNLHSPMYYFVCCLAVSDLLVSVSNVLETAVLLLLEAGALAAQAAVVQQLD NVMDVLICGSMVSSLCFLGAIAVDRYVSIFYALRYHSIVTLPRAGRAIAAIWAGSVLSST LFIAYYHHTAVLLGLVSFFVAmLALMAVLYVHmLARACQHGRHIARLHKTQHPTRQGCGL KGAATLTILLGVFLLCWAPFFLHLSLVVLCPQHPTCGCVFKNVNLFLALVICNSIVDPLI YAFRSQELRKTLQEVLQCSW Protein Names:Recommended name: Melanocyte-stimµLating hormone receptor Short name= MSH-R Alternative name(s): Melanocortin receptor 1 Short name= MC1-R Gene Names:Name:MC1R Expression Region:1-320 Sequence Info:fµLl length protein

1,673.00 € 1673.0 EUR 1,673.00 €

1,673.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF886941PI