ELISA Recombinant Interferon alpha-inducible protein 27-like protein 2(IFI27L2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9H2X8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAGLSTSSNILLASVGS VLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE Protein Names:Recommended name: Interferon alpha-inducible protein 27-like protein 2 Alternative name(s): Interferon-stimµLated gene 12b protein Short name= ISG12(b) Protein TLH29 pIFI27-like protein Gene Names:Name:IFI27L2 Synonyms:FAM14A, TLH29 Expression Region:25-130 Sequence Info:fµLl length protein