Skip to Content

ELISA Recombinant Mitochondrial 2-oxodicarboxylate carrier(SLC25A21)

https://www.paratuberculosis.info/web/image/product.template/135329/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BQT8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVmLLVYEYTYSWLQENW Protein Names:Recommended name: Mitochondrial 2-oxodicarboxylate carrier Alternative name(s): Solute carrier family 25 member 21 Gene Names:Name:SLC25A21 Synonyms:ODC Expression Region:1-299 Sequence Info:fµLl length protein

1,651.00 € 1651.0 EUR 1,651.00 €

1,651.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF883581HU