Skip to Content

ELISA Recombinant GTPase IMAP family member 2(GIMAP2)

https://www.paratuberculosis.info/web/image/product.template/133417/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9µg22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKT CSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTS QDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRIC AFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFK QSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCC LLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL Protein Names:Recommended name: GTPase IMAP family member 2 Alternative name(s): Immunity-associated protein 2 Short name= hIMAP2 Gene Names:Name:GIMAP2 Synonyms:IMAP2 Expression Region:1-337 Sequence Info:fµLl length protein

1,691.00 € 1691.0 EUR 1,691.00 €

1,691.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF883377HU