Skip to Content

ELISA Recombinant Potassium voltage-gated channel subfamily H member 2(KCNH2)

https://www.paratuberculosis.info/web/image/product.template/122015/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:Q9PT84 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QSWRAEASHVKPNPPNSTSDSDLMKYRTISQIPQFTLNFVEFNLEKHRSGSTTEIEIIAP HKVTERTQNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY TAVFTPYSAAFLLNEEQGEEKHWNCSYSCDPLNIIDLIVDIMFIVDIVINFRTTYVNIND EVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLIFRSGSDETTTLIGLLKTARLLRLVRVAR KLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYMEHKIGWLDNLGDQIGKRY NDSDLSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVmLIGSLMYASIF GNVSAIIQRLYSGTARYHTQmLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAV LKGFPDCLQADICLHLNRTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHYGDVL TTLYFISRGSIEILKEDIVVAILGKNDIFGEPISLYARPGKSNADV Protein Names:Recommended name: Potassium voltage-gated channel subfamily H member 2 Alternative name(s): Ether-a-go-go-related gene potassium channel 1 Short name= ERG-1 Short name= Eag-related protein 1 Short name= Ether-a-go-go-related p Gene Names:Name:KCNH2 Synonyms:ERG Expression Region:1-526 Sequence Info:fµLl length protein

1,890.00 € 1890.0 EUR 1,890.00 €

1,890.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF882474CH