ELISA Recombinant Membrane-spanning 4-domains subfamily A member 6A(MS4A6A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9H2W1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVL SLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVG SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKA SLAGTLSLmLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDC GYEELLTS Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 6A Alternative name(s): CD20 antigen-like 3 Four-span transmembrane protein 3 Gene Names:Name:MS4A6A Synonyms:4SPAN3, CD20L3, MS4A6 ORF Names:CDA01, MSTP090 Expression Region:1-248 Sequence Info:fµLl length protein